Therefore, your ISP will not know what youre up to. success: function(data) { "quiltName" : "ForumMessage", Pay attention to the message you get. This value can be changed back to "Top sites"to improve speeds if the "Top sites"list is sufficient. "action" : "addClassName" "context" : "", Keep in mind that theIP addresses these domains resolve towill be different regionally, so ensure you are allowing the correct, current IPs if using IP-based rules instead of FQDN rules on your upstream firewall. "context" : "", } Try to access the blocked website in this browser. "displayStyle" : "horizontal", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "event" : "expandMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", } ] }, { { "context" : "envParam:entity", ] "actions" : [ "context" : "", ] }, "event" : "MessagesWidgetCommentForm", "event" : "addMessageUserEmailSubscription", Edit: From your image, it looks like you do not have anything setup for content filtering anyway. }, Meraki what device? ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadComponent","parameters":{"componentId":"messages.widget.emoticons-lazy-load-runner"}},"tokenId":"ajax","elementSelector":"#inlinemessagereplyeditor_0","action":"lazyLoadComponent","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.inlinemessagereplyeditor_0:lazyloadcomponent?t:ac=board-id/security/message-id/2507/thread-id/2507","ajaxErrorEventName":"LITHIUM:ajaxError","token":"H_6hys-xa12QDEPDffkRHYRHtJZPbiKozyBBeSReXvo. Use IP Address of Website Address. }) { { 11-23-2017 12:46 PM. { }, } LITHIUM.AjaxSupport.ComponentEvents.set({ error: function() { It can be helpful to simply type the name of the site into major search engines, like Google or Bing. VPN requires no complicated setup, are generally stable, and more reliable. "event" : "expandMessage", }, "context" : "envParam:quiltName,message", and our "action" : "pulsate" { }, ] Checking your browser. "messageViewOptions" : "1101110111111111111110111110100101111101", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" ] "entity" : "10199", "actions" : [ { "context" : "envParam:quiltName", "selector" : "#messageview_3", "viewOrderSpec" : "UcXZ18CFHV4MAGth24oGNEaGrj1Af0qM0Fp5LWiZg9yE2MGql2toJv2vDa799oB6agHE8s5OuHk2M3kQyBPvSOyYlMA3wvzIDe4ADk0O91BJJypigAkKjxwU-qE9yJaYJxZXR_CJsGkTed1GmI-UMFsTGpMZvD-jShOCd0p58rJoEOzw76MtF4p00pzzDT0ctZ2fmNQiG1TzoNnKITCAD0UnDa0CPViUfxv_HdoAHCjqjy-TX_hLP2_zQZ_uN2DUbrhrFwhuJVNcjQrJrGj14HklgNm0IUYv4u0SN0MIhr0Cne7vGVp8gxT7KEDp0xjGRGPP3fPNWeqxCCZK-ggMS2DDJwIyhkz08zYZYIVCC4l-jvd0aVhJoS5BdZQVZoCMAfTXGzD1kcXlnXBe-PnJDSLGH87kKnzlThTt3RjvUwhFHMuDJq6U8vOfEfHX7FtFdS3yFe3E0NqSDI3nqfmWTj2sOMujy-sdg-zXyVjLNrZO6SkSh9Hw659BAc5uTnNpKukhMndgArfSZx_T5x1l0AI2EnIG1Rtt2vohuUBZMvQ." "disallowZeroCount" : "false", "event" : "addMessageUserEmailSubscription", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_2","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_2","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/2507/thread-id/2507&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"KqfIGu2vsDNHDg7QiRKtcMzTDznIwLcWyLwx-QbJigg. "context" : "", "actions" : [ "action" : "rerender" "event" : "expandMessage", Google Search results might show labels such as "This site may harm your computer" or "This site may be hacked . "actions" : [ Why is a site being blocked when itshouldnotbe? ] "actions" : [ ] 01-28-2018 01:41 PM. } "event" : "MessagesWidgetEditAction", { "eventActions" : [ { "}); "useSubjectIcons" : "true", "actions" : [ "context" : "", { "action" : "rerender" ] { "kudosLinksDisabled" : "false", }); If the blocked website has been cached, the cached page will be displayed in the browser. ] ], "context" : "lia-deleted-state", I get error connection timed out in chrome. // just for inline syntax-highlighting })(LITHIUM.jQuery); // Pull in global jQuery reference "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "truncateBody" : "true", "disableLinks" : "false", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","renderEventParams":{"replyWrapperId":"replyWrapper_4","messageId":10505,"messageActionsId":"messageActions_4"},"isRootMessage":false,"collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "event" : "QuickReply", QUIC connections in Private Relay are set up using port 443 and TLS 1.3, so make sure your network and server are ready to handle these connections. ], } "action" : "rerender" { { }, "quiltName" : "ForumMessage", "event" : "QuickReply", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "action" : "rerender" LITHIUM.lazyLoadComponent({"selectors":{"elementSelector":"#inlinemessagereplyeditor_0"},"events":{"lazyLoadComponentEvent":"LITHIUM:lazyLoadComponent"},"misc":{"isLazyLoadEnabled":false}}); "initiatorBinding" : true, }, The following instructions outline troubleshooting steps for a number of common issues regarding the block page: Viewing Blocked and/or Whitelisted Devices on Meraki Dashboard, To block a specific website or page, add the URL pattern for the webpage under, To block a category of websites, select the website category under. "event" : "markAsSpamWithoutRedirect", "actions" : [ { Content filtering can be used to filter content passing through your security appliance based on content known to exist on specified web pages. { }, { "actions" : [ } { "event" : "MessagesWidgetEditAction", "truncateBody" : "true", There is a whitelist that can be applied by navigating to Security & SD-WAN > Configure > Threat protection. } "context" : "", { { } While "twitter.com"was allowed, theimage/content hosting domain "twimg.com"was not. Cisco Merakiappliances and access pointscan be configured with Layer 7 firewall rules to block traffic by applicationor destinationhostname. "context" : "", "actions" : [ ] { "event" : "AcceptSolutionAction", Comment *document.getElementById("comment").setAttribute( "id", "af97f99bac10d5e4a30d75f869aeb8c1" );document.getElementById("e505a57ce4").setAttribute( "id", "comment" ); WatchSeries: Free Streaming Site | Safe to Use? Are you sure you want to proceed? { { // if the target of the click isn't the container and not a descendant of the container then hide the search "kudosable" : "true", { { "action" : "rerender" There are many online services which provide secure encrypted proxy server especially if you are using a Wi-Fi network. "context" : "envParam:quiltName,message,product,contextId,contextUrl", Step 3. "event" : "unapproveMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'ier9-S88if7nxKrhiWdi-Nic2b5lv0aPjwHEUBM8u10. { { "context" : "", ] } ] }, "context" : "envParam:quiltName,product,contextId,contextUrl", "messageViewOptions" : "1111110011111111111110111110100101111101", { $(document).ready(function () { { "action" : "rerender" "showCountOnly" : "false", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "initiatorDataMatcher" : "data-lia-message-uid" "message" : "10599", } { } In most cases, using a VPN help in accessing blocked sites. { Type the two DNS servers in the corresponding fields. "context" : "envParam:selectedMessage", "actions" : [ { "actions" : [ "useSimpleView" : "false", }, "useSubjectIcons" : "true", ] "action" : "rerender" "context" : "envParam:feedbackData", }); "truncateBodyRetainsHtml" : "false", }, Whenever you use a Smart DNS, all your traffic will be routed through it so that it seems youre in a whole different location. } "action" : "pulsate" Get notified when there are additional replies to this discussion. $search.removeClass('is--open'); Example: } $search.find('input.search-input').keyup(function(e) { "event" : "MessagesWidgetMessageEdit", ] "}); Many online services got smart and detected VPN traffic without too much effort. ] "event" : "approveMessage", When looking at the security appliancenetwork in the dashboard, navigate to Network-wide > Monitor > Event log. "action" : "rerender" This goes for both blocking and unblocking content. { { "action" : "rerender" { { "actions" : [ "event" : "AcceptSolutionAction", "action" : "rerender" I still use the Ultrasurf app on my mobile to connect with any public Wi-Fi for security and privacy. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_0","componentSelector":"#threadeddetaildisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":10199,"confimationText":"You have other message editors open and your data inside of them might be lost. "entity" : "10199", Our Blocked project aims to improve transparency about web blocking filters used by mobile phone companies and Internet Service Providers (ISPs). It will try to connect you to a pages https site automatically. } "event" : "ProductMessageEdit", LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchformV32_e2e384343fe895","nodesModel":{"tkb|tkb":{"title":"Knowledge base","inputSelector":".lia-search-input-tkb-article"},"security|forum-board":{"title":"Search Board: Security / SD-WAN","inputSelector":".lia-search-input-message"},"meraki|category":{"title":"Search Community: Security / SD-WAN","inputSelector":".lia-search-input-message"},"enterprise|category":{"title":"Search Category: Security / SD-WAN","inputSelector":".lia-search-input-message"},"user|user":{"title":"Users","inputSelector":".lia-search-input-user"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_e2e384343fe895_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "context" : "", "event" : "unapproveMessage", (Go to Manage Extensions if you cannot find them) When you find it, go to the extension's Options. ] { ] "showCountOnly" : "false", Make sure there are no lines of text after the comment lines (the one starting with #). URL whitelisting can be found on the content filtering page. "actions" : [ ] LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","renderEventParams":{"replyWrapperId":"replyWrapper","messageId":10183,"messageActionsId":"messageActions"},"isRootMessage":true,"collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "actions" : [ "componentId" : "kudos.widget.button", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","renderEventParams":{"replyWrapperId":"replyWrapper_3","messageId":10283,"messageActionsId":"messageActions_3"},"isRootMessage":false,"collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", Though the ISP speed would drop significantly but had no other options. } ] { }, { } }); "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'g4NThM-_vvBdlfsfSll2fPxupeygSAVKdDCV3IIgE20. "actions" : [ Additionally, install the latest router firmware updates and enable all the radio options available on your device (Wi-Fi 2 to Wi-Fi 6). "context" : "", However, any search that is made through HTTPS/SSL will not be affected by this setting. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Category filtering provides a list of categories thatcan be selected to block all web traffic destined to a URL/IP that matches with these categories on a hosted list. } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); The way domain names work is that when you type one into your browser, such as google.com, your browser is directed to a server. "message" : "10199", "message" : "10283", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", "action" : "rerender" { "event" : "MessagesWidgetMessageEdit", "context" : "envParam:quiltName", ] I think it will be useful for you to understand how admins actually block the sites and think of any other methods apart from mentioned. }); } ] '); { "event" : "ProductAnswer", "context" : "", "action" : "rerender" } { if ($(this).hasClass("disable-hovercard")) { "parameters" : { } "action" : "rerender" // Why .each()? "entity" : "10200",
Take Control with Web Content Filtering Software - Cisco Umbrella "componentId" : "forums.widget.message-view", "actions" : [ { } { }, "displaySubject" : "true" } "event" : "expandMessage", ] { Select Settings. } ] evt.stopPropagation(); } "actions" : [ "actions" : [ }, }, { How to Fix Spotify Web Player Not Working on Safari Mac? "action" : "pulsate" "event" : "RevokeSolutionAction", { Firewall or antivirus software may have blocked the connection.ERR_NETWORK_ACCESS_DENIED Solution: How to unblock Internet a. This will help in connection with the Google Public DNS server and access the website. To check if the device has been whitelisted on the MX, consult the following article -. Try finding the client you are testing with by navigating to. Best Fire TV Stick Apps | TV, Movies, Games and More, Fix: Tor Failed to Establish a Network Connection in Windows 11 and Linux PC, How to Fix the Stdole32.tlb Error in Windows 11. "useSimpleView" : "false", ] "context" : "", ] }, ] "componentId" : "kudos.widget.button", }, If a site is not in the list of "Top sites,"the URL will have to be looked up and this will noticeably affect browsing speeds. To access any platform from your Wi-Fi connection, youll have to take a look at your configuration and ask yourself why is the Internet provider blocking certain websites. "action" : "rerender" } "eventActions" : [ "componentId" : "labels.widget.labels.sortable", "parameters" : { { "actions" : [ If it doesn't work, clear the cache and cookies on your browser and try accessing the website again. { { "context" : "", Sometimes, sites will be blocked even though their URL category is not blocked. { "event" : "RevokeSolutionAction", } "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" ] }, } "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { If this is occurring, be sure sure to consider each of the following factors: Content Filtering and Threat Protection over Full-tunnel Site-to-site VPN. Luckily, there are ways to fix any restriction, and we'll show you below how to do it. Are you sure you want to proceed? "selector" : "#kudosButtonV2", Are you sure you want to proceed? "event" : "AcceptSolutionAction", "context" : "envParam:entity", "event" : "ProductAnswerComment", { Check to make sure that the URL is not in the URL whitelist on the content filtering page. Instead, the MX will force the request to timeout (an example of which can bee seen in Fig. This may result in some variations between what the tool reports for such URLsand what the MX will actually classify them as. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:feedbackData", ] } } { "event" : "MessagesWidgetCommentForm", "action" : "rerender" "displayStyle" : "horizontal", "}); } 2.
How to unblock and access Blocked or Restricted Websites ] { { }, The more vague a block pattern is, the more likely it is to block the entire domain. "kudosLinksDisabled" : "false", If you've any thoughts on Unblock and Visit the Sites Blocked by Network Administrator [7 Solutions], then feel free to drop in below comment box. Right-click your active Internet connection and select. "disallowZeroCount" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}});
Unblock Websites at School or Work with VPN, Tor or Proxy | AVG LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_e2e384343fe895","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } } })(LITHIUM.jQuery); } } 1. { If,for some reason, the IP has a different categorization then the URL, the client could be allowed through. "actions" : [ Also, please subscribe to our DigitBin YouTube channel for videos tutorials. "eventActions" : [ }, "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_e2e384343fe895_1","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/2507/thread-id/2507&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); To help narrow down the scope, the event type "Content filtering blocked URL"can be included in the "Event type include"field. "quiltName" : "ForumMessage", "eventActions" : [ ] "disableKudosForAnonUser" : "false", Method 3. } "action" : "rerender" In other words, if you're connected to a VPN located in Iceland, all your network traffic will be redirected to Iceland before it emerges. Your daily dose of tech news, in brief. "event" : "AcceptSolutionAction", "action" : "rerender" { "event" : "addThreadUserEmailSubscription", "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", ","type":"POST","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.recommendedcontenttaplet:lazyrender?t:ac=board-id/security/message-id/2507/thread-id/2507&t:cp=recommendations/contributions/page"}, 'lazyload'); "actions" : [ LITHIUM.InlineMessageReplyEditor({"openEditsSelector":".lia-inline-message-edit","ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. The more specific/lengthy a URL block entry is, the less likely it is to block the entire website. "action" : "rerender" Connect to a server in another region (where the website is less likely to be blocked). { "actions" : [ This process can sometimes take up to tenminutes. } Go to your router Settings, select Wi-Fi, and then click on your Access Point. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_1","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_1","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/2507/thread-id/2507&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iHjSVXlmen9-b0LidWhkeAd06kPDI5WBSa7cVcguYao. "action" : "rerender" "actions" : [ { }, Ive mentioned a few methods that work for bypassing the administrator setting on the network to access blocked sites. }, ], 1 Login to Cisco Meraki Dashboard first 2 Open then desired Network 3 Navigate to Network-wide -> Event Log (Under the MONITOR section) 4 In the Event type include field, we type Content filtering, Click on Content filtering blocked URL 5 Change other fields if necessary 6 Click on Search button Reddit and its partners use cookies and similar technologies to provide you with a better experience. Are you sure you want to proceed? LITHIUM.Placeholder(); In instances where another firewall is positioned upstream fromthe MX, the following FQDN destinations need to be allowed in order for categorization information traffic to pass successfully to the MX, so it can use the proper category classifications. "actions" : [ "disableLinks" : "false", "action" : "rerender" { I have a situation that I need some guidance on. "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", If there is nothing obvious under Content Filtering, this may be being applied via Group Policy instead (which may explain why it's a problem for some users and not others). Are you sure you want to proceed?
Unblock and Visit the Sites Blocked by Network Administrator [7 Solutions] var text = ""; To do so follow the steps below. } ], "action" : "rerender" }, Build resilient SD-WAN connectivity with integrated wired and cellular WAN, switching, and Wi-Fi { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); } To answer your question though, it is probably by MAC Address that is the piece of data used to recognise the device by a network. "event" : "editProductMessage", ] LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); } "kudosLinksDisabled" : "false", "actions" : [ ] { "action" : "rerender" { "action" : "rerender" ] "forceSearchRequestParameterForBlurbBuilder" : "false", { "kudosable" : "true", "disallowZeroCount" : "false", "context" : "", "context" : "", } Tor is often used to access websites that are blocked by the country or region you live in. dataType: 'html', "actions" : [ Got Qs? If it doesnt fall within legal regulations, the ISP might block it without prior notice. Make sure that the client you are configuring is not whitelisted. }, "initiatorDataMatcher" : "data-lia-message-uid" "event" : "removeMessageUserEmailSubscription", You can just verify it and click on "Add this Network" to configure your network with OpenDNS servers. "action" : "rerender" Web search filtering is not filteringsearches, Hosted email applicationsare being blocked, Blocked URL patterns are not being blocked, Whitelisted URL patterns are not being allowed, Configuring Active Directory with MX Security Appliances, www.example.com?url=www.dashboard.meraki.com. { "event" : "MessagesWidgetAnswerForm", "useSubjectIcons" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" ","messageActionsSelector":"#messageActions_3","loaderSelector":"#loader","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_3","loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false,"linearDisplayViewSelector":".lia-linear-display-message-view","threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","isLazyLoadEnabled":false,"layoutView":"threaded","isAllowAnonUserToReply":true,"replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true});